PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10025855m
Common NameCICLE_v10025855mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 379aa    MW: 41783.3 Da    PI: 8.4128
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10025855mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.9e-2589133145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Ciclev10025855m  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEA 133
                      79****************************************996 PP

2QLQ58.91.5e-202156136
              QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                     s+FT++Qlq+L++Q+l++Ky+++++P+PpeL+  ++
  Ciclev10025855m 21 SPFTPTQLQELEHQALIFKYMVSGVPIPPELIYSVK 56
                     89*****************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-122157IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-152255IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.2042257IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.47989133IPR014977WRC domain
PfamPF088793.6E-2190132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MMTVGGATTS CGARDHSIIR SPFTPTQLQE LEHQALIFKY MVSGVPIPPE LIYSVKRSLD  60
SSLVSSLFPP QAPHVGWGCF QVGFGRKADP EPGRCRRTDG KKWRCSKEAY PDSKYCERHM  120
HRGRNRSRKP VEAQALTSSS VPNISSSSTA SNPNPNPSPS LNKKLSINTP ISSVSSSYPF  180
SPSSSISPEL YAYQDPSQKS CAHINPLLCP HSSSSSRPPG SSSFSIHDNV TTRHLFLDSG  240
SCSQTDKDYS YNFHGIREGA VDERAFFPEA SGSIRSFQDS CPGPLVTIDG SYNKTYPHHS  300
QFQSFSDSIK QQQQQQQQHC FVLGTDFKSS AATERTVVKA ENEDKTQKPL HHFFGEWPPK  360
STDSWLDLSS NSRIHSDS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150424e-52AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426651.10.0hypothetical protein CICLE_v10025855mg
TrEMBLV4SRX90.0V4SRX9_9R
STRINGPOPTR_0001s16920.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45672651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-63growth-regulating factor 5